Everything below concerns Karl Fischer titration. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2025-07-23. Where a claim depends on a specific study, the study is described rather than over-claimed.
Creatine monohydrate is sold as a dietary ingredient in some countries and as a food supplement in others. Regulatory frameworks vary, so purity limits, labeling rules, and permitted claims are not globally uniform. In the United States, it falls under dietary supplement rules, whereas the European Union treats it as a food supplement ingredient. Pharmacopeial monographs, where they exist, can provide public quality standards, but not every product is required to meet them. Questions about long-term effects and patterns of use remain areas of active study rather than settled regulatory findings.
Solid creatine monohydrate is generally stable when kept cool and dry, but it can hydrolyze to creatinine over time. Moisture, heat, and acidic conditions accelerate this conversion, which reduces assay values and changes the material's properties. Creatinine is a cyclic dehydration product that is also a normal human metabolite, so its presence in a sample is not necessarily a health concern by itself. In quality testing, creatinine is monitored as a marker of degradation and purity.
Regulatory status varies by country. In the United States, creatine monohydrate is sold as a dietary supplement ingredient, while in the European Union it is placed on the market as a food supplement component. Some jurisdictions have established purity monographs or permitted health claims, while others treat it as a novel food or require notification. Product labels may state the amount of creatine monohydrate or the equivalent creatine content, and the two figures can differ. Independent testing programs sometimes check identity, potency, and contaminant limits.
Creatine monohydrate is stable under dry, cool conditions but can degrade when exposed to moisture and heat. In solution, it undergoes hydrolysis to creatinine, a cyclic derivative with little role in phosphagen energy transfer. The rate of conversion increases with temperature, storage time, and acidic or alkaline pH. Solid material kept in a sealed container at room temperature generally retains its composition for extended periods. Moisture uptake is a primary concern because it can accelerate breakdown and caking.
Analytical laboratories commonly use high-performance liquid chromatography to separate creatine from creatinine and related impurities. Ion chromatography, nuclear magnetic resonance, and titration assays can also quantify the compound. Water content is measured by Karl Fischer titration or loss on drying, because the monohydrate has a defined theoretical water fraction. Particle size, bulk density, and flowability are physical properties that affect blending and capsule filling. These measurements support quality control and help verify that a lot matches its specification.
| Property | Value | Notes |
|---|---|---|
| Purity (typical) | ≥99% by HPLC | Supplement and pharmacopeial grades vary |
| Water content | ≈12.1% theoretical | Measured by Karl Fischer titration |
| Creatinine limit | Often ≤0.1% in pharmacopeial grade | Supplement specifications may differ |
| Storage conditions | 15–25 °C, low humidity | Away from heat and acidic environments |
| Common analytical methods | HPLC–UV, NMR, FTIR, Karl Fischer | Used for identity, assay, and water content |
AnIML Core AnIML Technique Definitions Additionally, AnIML Technique Definition Documents apply constraints to the AnIML Core and are specified by the AnIML Technique Definitions. The AnIML Core consists of a set of rules defining the structure of the XML document, providing a universal container for arbitrary analytical data. AnIML Technique Definitions describe how to use the AnIML Core to record experiments of a particular scientific discipline. There is a big similarity between the mechanisms of AnIML and the AVI format. The AnIML Core defines the data container, whereas the AnIML Technique Definitions act similar to the AVI codec. It defines how the data needs to be structured and labeled. Technique Definitions are XML documents, specified by the Technique Schema. official website AnIML on GitHub
H3A (aq) + H2O (l) ⇌ H3O+ (aq) + H2A− (aq) Ka1 H2A− (aq) + H2O (l) ⇌ H3O+ (aq) + HA2− (aq) Ka2 HA2− (aq) + H2O (l) ⇌ H3O+ (aq) + A3− (aq) Ka3 An inorganic example of a triprotic acid is orthophosphoric acid (H3PO4), usually just called phosphoric acid. All three protons can be successively lost to yield H2PO−4, then HPO2−4, and finally PO3−4, the orthophosphate ion, usually just called phosphate. Even though the positions of the three protons on the original phosphoric acid molecule are equivalent, the successive Ka values differ since it is energetically less favorable to lose a proton if the conjugate base is more negatively charged. An organic example of a triprotic acid is citric acid, which can successively lose three protons to finally form the citrate ion. Although the subsequent loss of each hydrogen ion is less favorable, all of the conjugate bases are present in solution. The fractional concentration, α (alpha), for each species can be calculated. For example, a generic diprotic acid will generate 3 species in solution: H2A, HA−, and A2−. The fractional concentrations can be calculated as below when given either the pH (which can be converted to the [H+]) or the concentrations of the acid with all its conjugate bases:
Formation of the Quinonoid Intermediate PLP acts as an 'electron sink' absorbing delocalized electron density during the reaction intermediates (countering the excess electron density on the deprotonated a-carbon). PLP facilitates the enzyme activity, increasing the acidity of the alpha carbon by stabilizing the conjugate base. The PLP-stabilized carbanion intermediate formed is the quinonoid intermediate. Tyrosine and PLP stabilized 3C-Ring formation PLP and Tyrosine stabilize negative charges during deprotonation. Tyrosine attacks the sulfur bound carbon, allowing S(CH3)(Ado) to leave, and during ring formation, Tyrosine leaves. Note inhibitors AVG and AMA bind PLP to form a ketimine and oxime respectively (whose reverse reactions are much less favorable) and prevent the ACC synthase catalyzed reaction with SAM.
3-phosphoglycerate can be separated and measured using paper chromatography as well as with column chromatography and other chromatographic separation methods. It can be identified using both gas-chromatography and liquid-chromatography mass spectrometry and has been optimized for evaluation using tandem MS techniques. 2-Phosphoglyceric acid Calvin-Benson cycle Photosynthesis Ribulose 1,5-bisphosphate
Aminoacyl-tRNA synthetase enzymes consume ATP in the attachment tRNA to amino acids, forming aminoacyl-tRNA complexes. Aminoacyl transferase binds AMP-amino acid to tRNA. The coupling reaction proceeds in two steps: aa + ATP ⟶ aa-AMP + PPi aa-AMP + tRNA ⟶ aa-tRNA + AMP The amino acid is coupled to the penultimate nucleotide at the 3′-end of the tRNA (the A in the sequence CCA) via an ester bond (roll over in illustration). Transporting chemicals out of a cell against a gradient is often associated with ATP hydrolysis. Transport is mediated by ATP binding cassette transporters. The human genome encodes 48 ABC transporters, that are used for exporting drugs, lipids, and other compounds.
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Acids play important roles in the human body. The hydrochloric acid present in the stomach aids digestion by breaking down large and complex food molecules. Amino acids are required for synthesis of proteins required for growth and repair of body tissues. Fatty acids are also required for growth and repair of body tissues. Nucleic acids are important for the manufacturing of DNA and RNA and transmitting of traits to offspring through genes. Carbonic acid is important for maintenance of pH equilibrium in the body. Human bodies contain a variety of organic and inorganic compounds, among those dicarboxylic acids play an essential role in many biological behaviors. Many of those acids are amino acids, which mainly serve as materials for the synthesis of proteins. Other weak acids serve as buffers with their conjugate bases to keep the body's pH from undergoing large scale changes that would be harmful to cells. The rest of the dicarboxylic acids also participate in the synthesis of various biologically important compounds in human bodies.
Microscale manipulation and patterning of biological materials such as proteins, cells and tissues have been used in the development of cell-based arrays, microarrays, microfabrication based tissue engineering, and artificial organs. Biological micropatterning can be used for high-throughput single cell analysis, precise control of cellular microenvironment, as well as controlled integration of cells into appropriate multi-cellular architectures to recapitulate in vivo conditions. Photolithography, microcontact printing, selective microfluidic delivery, and self-assembled monolayers are some methods used to pattern biological molecules onto surfaces. Cell micropatterning can be done using microcontact patterning of extracellular matrix proteins, cellular electrophoresis, optical tweezer arrays, dielectrophoresis, and electrochemically active surfaces.
In molecular biology, the BtpA protein family is a family of proteins which includes BtpA. BtpA appears to play a role in the stabilisation of photosystem I. It is an extrinsic membrane protein located on the cytoplasmic side of the thylakoid membrane. Homologs of BtpA are found in the Thermoproteota and "Euryarchaeota", where their function remains unknown. The Ycf4 protein is firmly associated with the thylakoid membrane, presumably through a transmembrane domain. Ycf4 co-fractionates with a protein complex larger than PSI upon sucrose density gradient centrifugation of solubilised thylakoids. The Ycf3 protein is loosely associated with the thylakoid membrane and can be released from the membrane with sodium carbonate. This suggests that Ycf3 is not part of a stable complex and that it probably interacts transiently with its partners. Ycf3 contains a number of tetratricopeptide repeats (TPR); TPR is a structural motif present in a wide range of proteins, which mediates protein-protein interactions.
AM function can be compared to another peptide called pro-adrenomedullin N-terminal 20 peptide (PAMP), which both originate from a common precursor leading to angiogenesis, vasodilation, and anti-inflammatory processes. These two peptides are expressed in the gastrointestinal (GI) tract at a mass level, serving as GI hormones controlling processes like insulin secretion and gastric emptying. Past studies reveal that AM and PAMP also impact gut microbiome composition by fostering the development of beneficial bacteria (i.e., Bifidobacterium and Lactobacillus) and diminishing detrimental microbes.
Sources: en.wikipedia.org
Chinese hamster ovary (CHO) cells are a family of immortalized cell lines derived from epithelial cells of the ovary of the Chinese hamster, often used in biological and medical research and commercially in the production of recombinant therapeutic proteins. They have found wide use in studies of genetics, toxicity screening, nutrition and gene expression, and particularly since the 1980s to express recombinant proteins. CHO cells are the most commonly used mammalian hosts for industrial production of recombinant protein therapeutics.
thio-phosphorylated derivatives of resorcinols and calixarenes; studying thio-phosphorylated unsaturated compounds using petrochemical and wood-chemical feedstock; generation and theoretical study of phosphabetains and their derivatives (phosphonium salts, carboxyl-containing metal complexes); searching for liquid growth-boosting fertilizer compounds based on microelements. The following majors are currently offered to students: 04.03.01 Chemistry, Bachelor's degree program; 04.05.01 Fundamental and Applied Chemistry, Specialist Degree program; 04.04.01 Chemistry, Master's degree program; 44.03.01 Pedagogical Education, Bachelor's degree program. The following master's degree programs are offered by the Institute in the academic year 2015–2016:
5-HTP is decarboxylated to serotonin (5-hydroxytryptamine or 5-HT) by the enzyme aromatic-L-amino-acid decarboxylase with the help of vitamin B6. This reaction occurs both in nervous tissue and in the liver. 5-HTP crosses the blood–brain barrier, while 5-HT does not. Excess 5-HTP, especially when administered with vitamin B6, is thought to be metabolized and excreted. Though 5-HTP is found in food only in insignificant quantities, it is a chemical involved intermediately in the metabolism of tryptophan, an amino acid found in all unfractionated foods, with lower total amino acid content correlating with increased tryptophan absorption.
The above descriptions ignore the effects of Gβγ–signalling, which can also be important, in particular in the case of activated Gαi/o-coupled GPCRs. The primary effectors of Gβγ are various ion channels, such as G-protein-regulated inwardly rectifying K+ channels (GIRKs), P/Q- and N-type voltage-gated Ca2+ channels, as well as some isoforms of AC and PLC, along with some phosphoinositide-3-kinase (PI3K) isoforms.
Camurus aims to collaborate with biotechnology and pharmaceutical companies worldwide to enable and improve the delivery of a wide range of drug compounds. These compounds including peptides, proteins, and insoluble small molecules make use of delivery solutions ranging from long-acting depots to lipid nanocarriers designed for improved intravenous, transdermal, and oral delivery. Camurus' in-house product portfolio targets healthcare needs in areas of growth-hormone disorders, cancer, oncology supportive care, metabolic disease, and drug addiction. In 2007, British investors evaluated six nominated private companies and chose to Camurus as the best privately owned biotechnology company in the Medicon Valley. The company was awarded the Strictly Financing Award 2007. In 2013, Camurus was awarded CPhI Pharma Award for Best Innovation in Formulation.
Sources: en.wikipedia.org
A sealed container kept at room temperature and away from moisture is typical. Heat and humidity promote conversion to creatinine and can reduce assay values. Long-term storage under dry conditions helps maintain the original crystalline form.
Creatinine is a degradation product formed when creatine loses water and cyclizes. It can appear during storage, processing, or analysis if conditions are harsh. Quality specifications often set a maximum limit for creatinine to control purity.
No universal testing protocol applies across all markets. Some products follow pharmacopeial monographs, while others rely on manufacturer specifications and third-party certificates. Common tests include assay, water content, heavy metals, and microbial limits.
A sealed container at room temperature, away from moisture and direct heat, is suitable for most solid material. Keeping the lid closed limits water uptake and caking. Long-term storage in a refrigerator is not necessary if the powder remains dry.