A practical reference on Shelf life: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-11-09. Anything still debated is marked as such rather than presented as settled.
Commercial creatine monohydrate is typically manufactured through chemical synthesis, often starting from sarcosine and cyanamide. The resulting material is crystallized, washed, and dried to a specified hydrate content. Finished lots are tested for identity, purity, moisture, and heavy metals before release. Because the compound can cyclize to creatinine under heat or prolonged storage in solution, manufacturers control temperature and humidity during processing. The solid itself is relatively stable when kept dry and sealed, but moisture uptake can cause caking and complicate accurate assay.
Analytical laboratories commonly identify creatine monohydrate by high-performance liquid chromatography with ultraviolet detection, often after dissolving the sample in water or dilute acid. Ion-exchange or reversed-phase columns separate creatine from creatinine and related guanidino compounds. Nitrogen content can be checked by Kjeldahl or combustion methods, while moisture is measured by Karl Fischer titration or loss on drying. These techniques give complementary views: chromatographic purity addresses related substances, whereas moisture and elemental data confirm hydrate stoichiometry. No single test defines quality by itself; a combination is used in specifications.
Storage recommendations generally emphasize a cool, dry place away from direct sunlight and strong oxidizers. Sealed containers limit humidity exchange, which helps prevent clumping and gradual conversion to creatinine. Long-term stability studies usually monitor appearance, moisture, and purity at intervals under defined temperature and humidity conditions. Accelerated tests at elevated temperature can reveal degradation pathways, but they do not perfectly predict room-temperature shelf life. Questions remain about how much creatinine formation is acceptable in different product categories and how packaging choices affect that rate over time.
Laboratory analysis of creatine monohydrate typically uses high-performance liquid chromatography to separate creatine from creatinine and other impurities. Detection may be ultraviolet, refractive index, or mass spectrometric, depending on the laboratory's equipment and the required sensitivity. Nuclear magnetic resonance spectroscopy can quantify the main component and identify related substances. Water content is measured by Karl Fischer titration, which is important because the monohydrate has a defined theoretical hydration level. Heavy metals, residual solvents, and microbial limits are also checked in quality control programs.
Commercial creatine monohydrate is produced mainly by chemical synthesis rather than extraction from animal tissue. Suppliers provide a certificate of analysis listing assay, water content, and impurity limits, and some products undergo third-party testing. Verification of identity can use infrared or Raman spectroscopy alongside chromatographic methods. Storage recommendations generally call for a cool, dry place and a tightly closed container to limit moisture uptake. Open questions include how packaging, flavoring agents, and long-term storage affect the stability of finished products.
| Property | Value | Notes |
|---|---|---|
| Common analytical method | HPLC-UV | Separation from creatinine and related compounds. |
| Moisture content | Typically 12% theoretical | Monohydrate stoichiometry corresponds to about 12% water by mass. |
| Typical storage temperature | 15–25 °C | Cool, dry, sealed conditions limit moisture uptake. |
| Degradation marker | Creatinine | Formed by cyclization, especially in solution or with heat. |
| Solubility class | Moderately soluble in water | Solubility rises with temperature and varies with pH. |
In dry solid form, creatine monohydrate is relatively stable when protected from moisture and heat. The crystal lattice includes water, and exposure to high humidity can cause caking or gradual changes in powder flow. Elevated temperatures may accelerate decomposition, particularly if moisture is present. Studies generally report that sealed, dry material retains acceptable purity for extended periods, although exact shelf life depends on packaging and storage conditions. Light exposure is not usually considered a major factor for this compound.
In aqueous solution, creatine monohydrate undergoes a slow conversion to creatinine, a cyclized degradation product. This reaction is pH- and temperature-dependent, and it proceeds faster in warm or alkaline conditions. Because the conversion is gradual, analytical measurements of creatine in solution must account for time and storage history. The equilibrium favors creatinine more strongly at higher temperatures, which is relevant to sample handling in laboratories and to beverage formulations. Refrigeration slows but does not entirely stop this process.
Quality assessment of creatine monohydrate typically uses high-performance liquid chromatography to separate creatine from creatinine and other impurities. Other methods include nuclear magnetic resonance spectroscopy, titration, and infrared spectroscopy for identity confirmation. Purity is often reported as a percentage of the labeled compound on a dry basis, while moisture content is measured separately. Because different analytical methods have different selectivity, comparing purity values across sources requires attention to the method and sample preparation.
Quality control for creatine monohydrate begins with identity confirmation and assay determination. Laboratories commonly use high-performance liquid chromatography with ultraviolet detection, often after derivatization or using a suitable column, to quantify creatine. Karl Fischer titration measures water content, which helps verify the monohydrate stoichiometry. Additional tests screen for heavy metals, residual solvents, and microbial contamination depending on the intended use. These tests establish composition and purity rather than biological effect.
Stability studies examine how creatine monohydrate changes under controlled temperature and humidity. The solid is generally stable when kept dry, but moisture can promote hydrolysis to creatinine, especially in solution or at elevated temperatures. Color, odor, and assay values are monitored over time to detect degradation. Because degradation pathways depend on storage conditions, shelf-life claims should specify the tested packaging, temperature, and humidity. Open questions remain about the long-term behavior of different crystal habits and particle sizes.
Regulatory treatment of creatine monohydrate varies by country and intended use. In some jurisdictions it is sold as a dietary supplement, while in others it may be treated as a food ingredient or a pharmaceutical raw material. Pharmacopeial monographs, where available, define identification, assay limits, and impurity thresholds. Manufacturers often follow these monographs or internal specifications to ensure batch-to-batch consistency. Analytical method validation is important because different methods can yield different apparent purity values if sample preparation or detection conditions are not controlled.
In solid form, creatine monohydrate is relatively stable when kept dry and away from heat. Moisture and elevated temperatures promote cyclization into creatinine, a related compound with no role in the phosphagen system. Degradation accelerates in aqueous solution, where the conversion can occur within hours to days depending on pH and temperature. Manufacturers typically recommend storage in sealed containers at room temperature, with relative humidity below 50 percent. Long-term stability data for opened containers are limited.
Analytical methods for creatine monohydrate focus on identity, purity, and degradation products. High-performance liquid chromatography with ultraviolet detection is common, often at a wavelength near 210 nanometers. Titration and nuclear magnetic resonance spectroscopy can also quantify the parent compound. Pharmacopeial monographs specify tests for appearance, solubility, water content, and related substances, including creatinine. Purity values above 99 percent are typical for pharmaceutical-grade material, though supplement-grade products vary. Independent verification can detect label discrepancies.
If lipid A, part of the lipopolysaccharide, enters the circulatory system it causes a toxic reaction by activating toll like receptor TLR 4. Lipid A is very pathogenic and not immunogenic. However, the polysaccharide component is very immunogenic, but not pathogenic, causing an aggressive response by the immune system. The sufferer will have a high temperature and respiration rate and a low blood pressure. This may lead to endotoxic shock, which may be fatal. The bacterial outer membrane is physiologically shed as the bounding membrane of outer membrane vesicles in cultures, as well as in animal tissues at the host–pathogen interface, implicated in translocation of gram-negative microbial biochemical signals to host or target cells. Host–pathogen interaction Maltoporin OMPdb Outer membrane efflux proteins Outer mitochondrial membrane
Casokinins and lactokinins, breakdown products of casein and whey, occur naturally after ingestion of milk products, especially cultured milk. Their role in blood pressure control is uncertain. The lactotripeptides Val-Pro-Pro and Ile-Pro-Pro produced by the probiotic Lactobacillus helveticus or derived from casein have been shown to have ACE-inhibiting and antihypertensive functions. In one study, L. helveticus PR4 was isolated from Italian cheeses.
A variety of natural and synthetic inhibitors of ATP synthase have been discovered. These have been used to probe the structure and mechanism of ATP synthase. Some may be of therapeutic use. There are several classes of ATP synthase inhibitors, including peptide inhibitors, polyphenolic phytochemicals, polyketides, organotin compounds, polyenic α-pyrone derivatives, cationic inhibitors, substrate analogs, amino acid modifiers, and other miscellaneous chemicals. Some of the most commonly used ATP synthase inhibitors are oligomycin and DCCD. E. coli ATP synthase is the simplest known form of ATP synthase, with 8 different subunit types. Bacterial F-ATPases can occasionally operate in reverse, turning them into an ATPase. Some bacteria have no F-ATPase, using an A/V-type ATPase bidirectionally. Yeast ATP synthase is one of the best-studied eukaryotic ATP synthases; and five F1, eight FO subunits, and seven associated proteins have been identified. Most of these proteins have homologues in other eukaryotes.
Treatments for ATTR-related neuropathy include TTR-specific oligonucleotides in the form of small interfering RNA (patisiran) or antisense inotersen, the former having recently received FDA approval. Research into treatments for ATTR amyloidosis have compared liver transplantation, oral drugs that stabilize the misfolding protein (including tafamidis and diflunisal), and newer therapeutic agents still being investigated (including patisiran). Based on available research, liver transplant remains the most effective treatment option for advanced ATTR amyloidosis, protein stabilizing drugs may slow disease progression but were insufficient to justify delay of liver transplant, and newer agents such as patisiran require additional studies. Peptide synthesis Proteinopathy
Sources: en.wikipedia.org
ALK-negative ALCL tumor cells show products made by chimeric genes: DUSP22-IRF4 (many of which are fused at particular site and termed DUSP22-FRA7H) in 30% of the cases; TP63-TBL1XR1 in 8% of cases; and NFKB2-ROS1, NCOR2-ROS1, NFKB2-TYK2, or PABPC4-TYK2 in rare cases. They also show mutations in the JAK1 and/or STAT3 genes in 18% of cases; the MSC gene in 15% of cases, and the NOTCH1 gene in 15% of cases. About 24% of cases have a truncated ERBB4 gene. DUSP22 gene rearrangements have been associated with favorable outcomes in ALK-negative ALCL while TP63 gene arrangements are often associated with a poorer prognosis in various cancers. ALK-negative ALCL cells overexpress overactive STAT3 in 47% of cases and JAK1 in many cases. Many of these gene abnormalities appear to contribute to the development of ALK-negative ALCL.
Individual transmembrane adenylyl cyclase isoforms have been linked to numerous physiological functions. Soluble adenylyl cyclase (sAC, AC10) has a critical role in sperm motility. Adenylyl cyclase has been implicated in memory formation, functioning as a coincidence detector. AC-IV was first reported in the bacterium Aeromonas hydrophila, and the structure of the AC-IV from Yersinia pestis has been reported. These are the smallest of the AC enzyme classes; the AC-IV (CyaB) from Yersinia is a dimer of 19 kDa subunits with no known regulatory components (PDB: 2FJT). AC-IV forms a superfamily with mammalian thiamine-triphosphatase called CYTH (CyaB, thiamine triphosphatase). These forms of AC have been reported in specific bacteria (Prevotella ruminicola O68902 and Rhizobium etli Q8KY20, respectively) and have not been extensively characterized. There are a few extra members (~400 in Pfam) known to be in class VI. Class VI enzymes possess a catalytic core similar to the one in Class III.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Automation of synthesis has three main benefits: increased efficiency, quality (yields and purity), security, and safety, all resulting from decreased human involvement. As machines work faster than humans and are not prone to human error, throughput and reproducibility increases. Additionally, as humans spend less time in the lab exposure to dangerous chemicals is significantly decreased. This allows chemists additional time for theory and collaborative discussions. Additional benefits include: multitasking, performing tasks beyond the scope of human precision or ability, exhaustive analysis, etc.
Alfred Zack Gilman (February 5, 1908 – January 13, 1984) was an American pharmacologist best known for pioneering early chemotherapy techniques using nitrogen mustard with his colleague, Louis S. Goodman. The pair also published the classic textbook The Pharmacological Basis of Therapeutics in 1941, and Gilman served as an editor for its first six editions. Gilman served on the faculties of the Yale School of Medicine, the Columbia College of Physicians and Surgeons, and the Albert Einstein College of Medicine, where he founded the Department of Pharmacology. He was a member of U.S. National Academy of Sciences.
The idea of hexapods being 'terrestrial crustaceans' is relatively recent, coming from a 2005 molecular analysis study. A 2013 study restructured the relationships within Pancrustacea, and first proposed the name Allotriocarida. The most recent study of Allotriocarida in 2019 provides additional evidence suggesting that Hexapoda and Remipedia are likely more closely related to each other than to Cephalocarida or Branchiopoda. As of 2024, the existence of Allotriocarida as a monophyletic group within Pancrustacea is now much more widely accepted than the Atelocerata classification which dates back to the 19th century. This formerly-held belief was that hexapods and myriapods (centipedes, millipedes, etc.) are more closely related to each other than they are to the Multicrustacea, based on morphological similarities in their tracheae, but this proposition has been contradicted by the aforementioned modern molecular phylogenetic studies. The most recent understanding of Allotriocarida, as described in the 2019 study, can be seen in the cladogram below.
Sources: en.wikipedia.org
Laboratories typically combine chromatographic separation with moisture and elemental analysis. High-performance liquid chromatography can quantify creatine and related substances such as creatinine. Moisture methods confirm the hydrate form and help detect excess water.
The dry crystalline solid is relatively stable when protected from moisture and heat. In solution, it can convert to creatinine over time, especially at higher temperatures. Storage conditions and product form influence the rate of change.
Moisture uptake can cause particles to stick together, particularly in humid conditions or after opening a container. Clumping does not necessarily mean the creatine has degraded. It can make accurate measuring more difficult, so dry storage and sealed packaging are used.
Purity testing often uses high-performance liquid chromatography to measure creatine and creatinine. Water content can be checked by Karl Fischer titration. Additional tests may cover heavy metals, residual solvents, and microbial contamination.