If you have been reading about Creatinine and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-04-18. Numbers and descriptions here follow the published literature rather than marketing material.
Creatine monohydrate is sold as a dietary ingredient in some countries and as a food supplement in others. Regulatory frameworks vary, so purity limits, labeling rules, and permitted claims are not globally uniform. In the United States, it falls under dietary supplement rules, whereas the European Union treats it as a food supplement ingredient. Pharmacopeial monographs, where they exist, can provide public quality standards, but not every product is required to meet them. Questions about long-term effects and patterns of use remain areas of active study rather than settled regulatory findings.
Solid creatine monohydrate is generally stable when kept cool and dry, but it can hydrolyze to creatinine over time. Moisture, heat, and acidic conditions accelerate this conversion, which reduces assay values and changes the material's properties. Creatinine is a cyclic dehydration product that is also a normal human metabolite, so its presence in a sample is not necessarily a health concern by itself. In quality testing, creatinine is monitored as a marker of degradation and purity.
Storage recommendations generally emphasize a cool, dry place away from direct sunlight and strong oxidizers. Sealed containers limit humidity exchange, which helps prevent clumping and gradual conversion to creatinine. Long-term stability studies usually monitor appearance, moisture, and purity at intervals under defined temperature and humidity conditions. Accelerated tests at elevated temperature can reveal degradation pathways, but they do not perfectly predict room-temperature shelf life. Questions remain about how much creatinine formation is acceptable in different product categories and how packaging choices affect that rate over time.
Commercial creatine monohydrate is typically manufactured through chemical synthesis, often starting from sarcosine and cyanamide. The resulting material is crystallized, washed, and dried to a specified hydrate content. Finished lots are tested for identity, purity, moisture, and heavy metals before release. Because the compound can cyclize to creatinine under heat or prolonged storage in solution, manufacturers control temperature and humidity during processing. The solid itself is relatively stable when kept dry and sealed, but moisture uptake can cause caking and complicate accurate assay.
| Property | Value | Notes |
|---|---|---|
| Purity (typical) | ≥99% by HPLC | Supplement and pharmacopeial grades vary |
| Water content | ≈12.1% theoretical | Measured by Karl Fischer titration |
| Creatinine limit | Often ≤0.1% in pharmacopeial grade | Supplement specifications may differ |
| Storage conditions | 15–25 °C, low humidity | Away from heat and acidic environments |
| Common analytical methods | HPLC–UV, NMR, FTIR, Karl Fischer | Used for identity, assay, and water content |
Stability studies typically examine the effects of temperature, humidity, and light on creatine monohydrate. Sealed containers stored in cool, dry conditions help limit moisture uptake and hydrolysis. Elevated temperature and high relative humidity can accelerate conversion to creatinine, especially in aqueous solutions. In solid dosage forms, excipients and processing steps may also affect stability. Published stability data are not fully consistent across studies because test conditions and analytical methods vary.
Quality control of creatine monohydrate relies on a combination of identity, purity, and moisture tests. High-performance liquid chromatography with ultraviolet detection is widely used to separate creatine from creatinine and other related nitrogenous compounds. Spectroscopic methods such as infrared and nuclear magnetic resonance provide structural confirmation. Because the material is a hydrate, water content is measured separately, often by Karl Fischer titration. These tests together establish whether a lot meets a defined specification.
Manufacturing processes can leave trace amounts of dicyandiamide, creatinine, or residual solvents, depending on the synthetic route and purification steps. Heavy metals, arsenic, and microbial contamination are also monitored for food or pharmaceutical grades. Particle size distribution can affect dissolution behavior and blending uniformity, so it may be specified for certain applications. Analytical results are reported on a dry basis or as-is basis, and the difference matters when comparing certificates of analysis. Open questions remain about how minor impurities influence long-term stability under varied storage conditions.
Identity and purity are commonly assessed by high-performance liquid chromatography, often with ultraviolet detection, and by spectroscopic techniques such as infrared or nuclear magnetic resonance. These methods can distinguish creatine from creatinine and detect related impurities. Moisture content may be measured by Karl Fischer titration or loss on drying. Particle size, bulk density, and heavy metal limits are additional quality parameters. Not every product is tested by every method, so specifications depend on the intended use and regulatory framework.
Solid creatine monohydrate is generally stable when kept dry and protected from extremes of heat and humidity. In the presence of moisture, it can gradually convert to creatinine, a cyclic dehydration product that has little value for phosphocreatine synthesis. Elevated temperatures and acidic conditions accelerate this conversion in solution. Because the reaction is slow in cool, dry storage, typical shelf lives are measured in years rather than weeks. Packaging that limits moisture and oxygen exposure helps maintain purity.
Recommended storage usually involves a sealed container kept at room temperature, away from direct sunlight and moisture. High humidity can cause caking, which changes flow properties and may complicate accurate weighing. Repeated opening of containers exposes the powder to air and moisture, so smaller aliquots can reduce handling effects. Storage temperature ranges are not absolute requirements; they reflect conditions that slow degradation and preserve consistent physical characteristics. Clean, dry tools help prevent contamination during sampling.
In aqueous solution, creatine monohydrate undergoes a slow conversion to creatinine, a cyclized degradation product. This reaction is pH- and temperature-dependent, and it proceeds faster in warm or alkaline conditions. Because the conversion is gradual, analytical measurements of creatine in solution must account for time and storage history. The equilibrium favors creatinine more strongly at higher temperatures, which is relevant to sample handling in laboratories and to beverage formulations. Refrigeration slows but does not entirely stop this process.
Quality assessment of creatine monohydrate typically uses high-performance liquid chromatography to separate creatine from creatinine and other impurities. Other methods include nuclear magnetic resonance spectroscopy, titration, and infrared spectroscopy for identity confirmation. Purity is often reported as a percentage of the labeled compound on a dry basis, while moisture content is measured separately. Because different analytical methods have different selectivity, comparing purity values across sources requires attention to the method and sample preparation.
In dry solid form, creatine monohydrate is relatively stable when protected from moisture and heat. The crystal lattice includes water, and exposure to high humidity can cause caking or gradual changes in powder flow. Elevated temperatures may accelerate decomposition, particularly if moisture is present. Studies generally report that sealed, dry material retains acceptable purity for extended periods, although exact shelf life depends on packaging and storage conditions. Light exposure is not usually considered a major factor for this compound.
Solid creatine monohydrate is relatively stable when kept dry and sealed, but heat and moisture accelerate its conversion to creatinine. This degradation involves intramolecular cyclization, a process that removes water and forms a less useful compound for phosphocreatine metabolism. Powder stored under cool, dry conditions can remain within specification for extended periods, though exact shelf life depends on packaging, humidity, and initial purity. Aqueous solutions degrade faster than dry powder, with pH and temperature influencing the rate. Because degradation is gradual, analytical testing is used to confirm potency at manufacture and during stability studies.
Quality control for creatine monohydrate typically combines identity, assay, and impurity tests. High-performance liquid chromatography with ultraviolet detection is common for separating creatine from creatinine and related substances. Nuclear magnetic resonance and infrared spectroscopy can confirm molecular structure, while titration may assess acid-base content. Moisture content, heavy metals, residual solvents, and microbial limits are checked according to applicable standards. These tests help distinguish compliant material from powders that have degraded, been diluted, or contain manufacturing residues.
Camurus aims to collaborate with biotechnology and pharmaceutical companies worldwide to enable and improve the delivery of a wide range of drug compounds. These compounds including peptides, proteins, and insoluble small molecules make use of delivery solutions ranging from long-acting depots to lipid nanocarriers designed for improved intravenous, transdermal, and oral delivery. Camurus' in-house product portfolio targets healthcare needs in areas of growth-hormone disorders, cancer, oncology supportive care, metabolic disease, and drug addiction. In 2007, British investors evaluated six nominated private companies and chose to Camurus as the best privately owned biotechnology company in the Medicon Valley. The company was awarded the Strictly Financing Award 2007. In 2013, Camurus was awarded CPhI Pharma Award for Best Innovation in Formulation.
Amazon services include its digital assistant Alexa, Amazon Music, and Prime Video for music and videos respectively, the Amazon Appstore for Android apps. Audible provides audiobooks for purchase and listening. RXPass is a US prescription drug delivery service. US Amazon Prime members can pay a $5 monthly fee for access to 60 medications. Beneficiaries of government healthcare programs such as Medicare and Medicaid are not eligible. Amazon Live is an e-commerce live-streaming service. The service allows promoters to stream live videos promoting or sponsoring products. Promoters (mainly celebrities or Internet influencers) can add tags to add context. Other users can watch and send messages to a global chat for any stream. In 2023 roughly a billion total viewers watched streams in the US and India. The platform is integrated into Amazon Freevee and Amazon Prime Video.
Cell biology is the branch of biology that studies the structure, function, and behaviour of cells. Bioenergetics is a field in biochemistry and cell biology that concerns energy flow through living systems. This is an active area of biological research that includes the study of the transformation of energy in living organisms and the study of thousands of different cellular processes such as cellular respiration and other metabolic and enzymatic processes that enable the use of energy. Genetics is the scientific study of inheritance. Classical genetics, specifically, is the study of how genes and traits are passed on from parents to offspring; its principles are called Mendelian inheritance. A Punnett square can be used to predict the results of a test cross. The chromosome theory of inheritance, which states that genes are found on chromosomes, was supported by Thomas Morgans's experiments with fruit flies, which established the sex linkage between eye color and sex in these insects.
Initial letters are used where there is no ambiguity: C cysteine, H histidine, I isoleucine, M methionine, S serine, V valine. No other amino acids in this set begin with each of those letters. Where arbitrary assignment is needed, the structurally simpler amino acids are given precedence: A alanine, G glycine, L leucine, P proline, T threonine. For example, alanine is simpler than arginine or asparagine, the other amino acids starting with "a". F PHenylalanine and R aRginine are assigned by being phonetically suggestive, W tryptophan is assigned based on the double ring being visually suggestive to the bulky letter W, K lysine and Y tyrosine are assigned as alphabetically nearest to their initials L and T (note that U was avoided for its similarity with V, while X was reserved for undetermined or atypical amino acids); for tyrosine the mnemonic tYrosine was also proposed, D aspartate was assigned arbitrarily, with the proposed mnemonic asparDic acid; E glutamate was assigned in alphabetical sequence being larger by merely one methylene –CH2– group, N asparagine was assigned arbitrarily, with the proposed mnemonic asparagiNe; Q glutamine was assigned in alphabetical sequence of those still available (note again that O was avoided due to similarity with D), with the proposed mnemonic Qlutamine.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Gingras research focuses on the development of experimental and bioinformatics approaches for functional proteomics, with a focus on protein-protein and proximity interactions. She applies these tools to the study of signaling pathways in health and disease and in mapping the physical organization of the dynamic proteome. Some of her work focuses on the consequence of disease-associated mutations on the interactions established by proteins. In addition to proteomics, Gingras laboratory has interest in studying human protein phosphatase and their systematic interactions and has now expanded into the field of systems biology.
Amitabha Chattopadhyay is an Indian scientist working in the areas of membrane and receptor biology and biophysics . He is presently a CSIR Bhatnagar Fellow at the Center for Cellular and Molecular Biology and served as the founding dean of biological sciences at the Academy of Scientific and Innovative Research (AcSIR). In addition, he is a distinguished visiting professor at the Indian Institute of Technology Bombay, adjunct professor at the Jawaharlal Nehru University (New Delhi), Tata Institute of Fundamental Research, Indian Institute of Science Education and Research (Kolkata), Swinburne University of Technology (Australia), and honorary professor at the Jawaharlal Nehru Centre for Advanced Scientific Research (Bangalore). He was elected a Fellow of the Royal Society of Chemistry in 2013 and Royal Society of Biology in 2017. Chattopadhyay has authored more than 300 research papers and has an h-index of 65. In 2016, Chattopadhyay won The World Academy of Sciences in Biology for his seminal contribution in understanding the role of membrane cholesterol in the organization and function in healthy and diseased conditions.
A carboxylic acid has the general formula R-C(O)OH, where R is an organic radical. The carboxyl group -C(O)OH contains a carbonyl group, C=O, and a hydroxyl group, O-H. Acetic acid (CH3COOH) Citric acid (C6H8O7) Formic acid (HCOOH) Gluconic acid HOCH2-(CHOH)4-COOH Lactic acid (CH3-CHOH-COOH) Oxalic acid (HOOC-COOH) Tartaric acid (HOOC-CHOH-CHOH-COOH) Halogenation at alpha position increases acid strength, so that the following acids are all stronger than acetic acid. Fluoroacetic acid Trifluoroacetic acid Chloroacetic acid Dichloroacetic acid Trichloroacetic acid Normal carboxylic acids are the direct union of a carbonyl group and a hydroxyl group. In vinylogous carboxylic acids, a carbon-carbon double bond separates the carbonyl and hydroxyl groups. Ascorbic acid Deoxyribonucleic acid (DNA) Ribonucleic acid (RNA) Listing of strengths of common acids and bases Zumdahl, Steven S. (1997). Chemistry (4th ed.). Boston: Houghton Mifflin. ISBN 9780669417944. Pavia, D. L.; Lampman, G. M.; Kriz, G. S. (2004). Organic Chemistry Volume I. Mason, OH: Cengage Learning. ISBN 0759347271.
After dendritic cells have phagocytosed pathogens, they usually migrate to the vast network of lymph vessels and are carried by lymph flow to the draining lymph nodes. Each lymph node is a collection point where APCs can interact with T cells. During the migration, DCs undergo a process of maturation: they lose most of their ability to further engulf pathogens and they mature by changing surface expression of MHC and co-stimulatory molecules, as well as increased production of cytokines. The internalized antigen is digested into smaller peptides containing epitopes, which are then presented to T cells by the MHC. B cells reside in the lymph node. Once their B cell receptor binds to an antigen, they can interact with activated helper T cells, as described above. A dendritic cell that interacts with an already-activated helper T cell can become licensed. This occurs through the interaction of co-stimulatory molecules including B7 and CD40 on the dendritic cell, with CD28 and CD40 ligand on the T cell. Only licensed dendritic cells are able to activate cytotoxic T cells. T cell licensing of dendritic cells is key for activation of cytotoxic T cells for many pathogens, although the extent to which T cell help is needed may vary. In MHC class I and class II molecules, only certain epitopes of an internalized peptide can be presented. These epitopes are termed immunodominant.
Amanda Grace Paulovich is an oncologist, and a pioneer in proteomics using multiple reaction monitoring mass spectrometry to study tailored cancer treatment. Paulovich received a BS in Biological Sciences from Carnegie Mellon University in 1988, a PhD in Genetics from University of Washington in 1996, under the direction of Leland Hartwell. She also received a MD from University of Washington in 1998. Follow her residency in Internal Medicine at Massachusetts General Hospital, she also completed a Postdoctoral Fellowship in Computational Biology at the Massachusetts Institute of Technology Whitehead Center for Genomic Research in 2003, and a Fellowship in Medical Oncology at the Dana Farber Cancer Institute in 2004.
Sources: en.wikipedia.org
Aspartate has many other biochemical roles. It is a metabolite in the urea cycle and participates in gluconeogenesis. It carries reducing equivalents in the malate-aspartate shuttle, which utilizes the ready interconversion of aspartate and oxaloacetate, which is the oxidized (dehydrogenated) derivative of malic acid. Aspartate donates one nitrogen atom in the biosynthesis of inosine, the precursor to the purine bases. In addition, aspartic acid acts as a hydrogen acceptor in a chain of ATP synthase. Dietary L-aspartic acid has been shown to act as an inhibitor of Beta-glucuronidase, which serves to regulate enterohepatic circulation of bilirubin and bile acids. Click on genes, proteins and metabolites below to link to respective articles. Aspartate (the conjugate base of aspartic acid) stimulates NMDA receptors, though not as strongly as the amino acid neurotransmitter L-glutamate does. Aspartate is the "A" in NMDA (N-methyl-D-aspartate receptor).
Some anesthetics and chemotherapy drugs are injected intrathecally into the subarachnoid space, where they spread around CSF, meaning substances that cannot cross the blood–brain barrier can still be active throughout the central nervous system. Baricity refers to the density of a substance compared to the density of human cerebrospinal fluid and is used in regional anesthesia to determine the manner in which a particular drug will spread in the intrathecal space. Liquorpheresis is the process of filtering the CSF in order to clear it from endogen or exogen pathogens. It can be achieved by means of fully implantable or extracorporeal devices, though the technique remains experimental today.
However, β-strands are rarely perfectly extended; rather, they exhibit a twist. The energetically preferred dihedral angles near (φ, ψ) = (–135°, 135°) (broadly, the upper left region of the Ramachandran plot) diverge significantly from the fully extended conformation (φ, ψ) = (–180°, 180°). The twist is often associated with alternating fluctuations in the dihedral angles to prevent the individual β-strands in a larger sheet from splaying apart. A good example of a strongly twisted β-hairpin can be seen in the protein BPTI. The side chains point outwards from the folds of the pleats, roughly perpendicularly to the plane of the sheet; successive amino acid residues point outwards on alternating faces of the sheet.
The MEROPS protease database includes the following ten families of asparagine peptide lyases, which are included in 6 different clans of proteases. Proteolytic enzymes are classified into families based on sequence similarity. Each family includes proteolytic enzymes with homologous sequences and common catalytic type. Clans are groups of proteolytic enzymes families with related structures, where catalytic type is not conserved. *Not yet included in IUBMB recommendations. The ten different families of asparagine peptide lyases are distributed in three different types: Viral coat proteins Autotransporter proteins Intein-containing proteins There are five families of viral coat proteins (N1, N2, N8, N7 and N5), two families of autotransporter proteins (N6 and N4) and three families of intein-containing proteins (N9, N10 and N11).
There have been many efforts to engineer and improve new AAV variants for both clinical and research purposes. Such modifications include new tropisms to target specific tissues, and modified surface residues to evade detection by the immune system. Beyond opting for particular strains of recombinant AAV (rAAV) to target particular cells, researchers have also explored AAV pseudotyping, the practice of creating hybrids of certain AAV strains to approach an even more refined target. The hybrid is created by taking a capsid from one strain and the genome from another strain. For example:
Sources: en.wikipedia.org
A sealed container kept at room temperature and away from moisture is typical. Heat and humidity promote conversion to creatinine and can reduce assay values. Long-term storage under dry conditions helps maintain the original crystalline form.
Creatinine is a degradation product formed when creatine loses water and cyclizes. It can appear during storage, processing, or analysis if conditions are harsh. Quality specifications often set a maximum limit for creatinine to control purity.
No universal testing protocol applies across all markets. Some products follow pharmacopeial monographs, while others rely on manufacturer specifications and third-party certificates. Common tests include assay, water content, heavy metals, and microbial limits.
Laboratories typically combine chromatographic separation with moisture and elemental analysis. High-performance liquid chromatography can quantify creatine and related substances such as creatinine. Moisture methods confirm the hydrate form and help detect excess water.