If you have been reading about peptide synthesis and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-03-30. Numbers and descriptions here follow the published literature rather than marketing material.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. Its design combines the ACTH(4-7) core fragment with a C-terminal Pro-Gly-Pro extension, a modification intended to improve stability and prolong activity. The molecule is hydrophilic, carries no lipid chains or glycosylation, and has a theoretical mass just over 810 daltons in its free form. All seven residues are proteinogenic amino acids, so no non-natural building blocks appear in the backbone. A free N-terminal methionine and C-terminal proline define the unmodified parent peptide.
The compound was developed during the 1980s at the Institute of Molecular Genetics in Moscow as part of research on fragments of adrenocorticotropic hormone. Early work examined short ACTH-derived sequences that retained neurotrophic effects while lacking the endocrine activity of the full hormone. Semax entered clinical use in Russia during the 1990s, where it received registration for several neurological indications. Outside that region it remained primarily a laboratory research material rather than an approved therapeutic. English-language literature on it grew more slowly and frequently cited the original Russian studies.
Terminology around the compound varies by source. It appears in catalogues and papers as Semax, as the heptapeptide ACTH(4-7)-Pro-Gly-Pro, and under various alphanumeric laboratory codes used by individual suppliers. These names refer to the same sequence but may imply different salt forms, purity grades, or counter-ions. Peptide databases usually list the free base mass, while product descriptions sometimes report acetate or trifluoroacetate salts with a different formula weight. Because naming conventions for research peptides are not standardised across vendors, checking the declared sequence and measured mass is more reliable than relying on a trade name alone.
The C-terminal Pro-Gly-Pro extension is not incidental. Proline-rich tails are known to resist several common peptidases, and the published literature attributes the longer half-life of Semax, relative to unmodified ACTH fragments, to this feature. The modification also removes the melanocyte-stimulating and corticosteroidogenic activity that characterizes longer ACTH-derived sequences. Because the molecule is small and hydrophilic, it is typically formulated as an aqueous solution for intranasal or parenteral delivery. Acetylation or amidation at the termini appears in closely related research peptides and shifts the mass by a fixed increment.
Reported pharmacological work centers on neurotrophic signaling, including changes in BDNF and NGF expression in hippocampal tissue in animal models. Human data come largely from studies conducted in Russia, and how well those results generalize to other populations remains an open question. Regulatory status differs sharply by jurisdiction: Semax is a registered prescription medicine in Russia, while it holds no approved marketing status in the United States or the European Union. Outside such jurisdictions it is generally handled as a research chemical, which affects both documentation and quality expectations.
Semax is a synthetic heptapeptide whose sequence is Met-Glu-His-Phe-Pro-Gly-Pro. It was developed as a fragment analog of adrenocorticotropic hormone, modeled specifically on the ACTH(4-10) region. The first four residues reproduce that fragment, while a Pro-Gly-Pro tripeptide is appended at the C-terminus. Work on the compound originated in Russia, where it entered clinical use as an intranasal preparation. Its sequence places it among short regulatory peptides studied for effects on the central nervous system rather than on the adrenal axis.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic heptapeptide | ACTH(4-7) analogue |
| Sequence | Met-Glu-His-Phe-Pro-Gly-Pro | Free N terminus, unmodified side chains |
| Molecular weight | 813.9 Da | Free base; salt forms differ |
| Appearance | White to off-white powder | Lyophilised solid |
| Solubility | Freely soluble in water | Hydrophilic; polar solvents preferred |
Later generations of the molecule include an N-acetylated form and an amidated form, both marketed online alongside the parent peptide. These variants differ in terminal chemistry and stability, and they are frequently discussed in the same breath even though they have not been compared in controlled trials. Supply outside formal healthcare systems comes largely from laboratories that synthesize peptides to order. Purity and identity of these materials vary widely, and no single body oversees the international trade.
Semax is a synthetic heptapeptide developed in the Soviet Union during the 1980s by researchers at the Institute of Molecular Genetics in Moscow. It was designed as a truncated analog of adrenocorticotropic hormone, retaining only the fragment spanning residues four through ten. Investigators sought a peptide that would preserve the cognitive effects associated with ACTH while eliminating the hormonal stimulation of the adrenal cortex. The compound entered clinical use in Russia during the following decade.
Russian regulatory authorities approved the peptide for nasal administration, and it remains listed in the national pharmacopoeia under several trade names. Documented indications include acute ischemic stroke, transient ischemic attacks, traumatic brain injury, and certain ophthalmological and neurological conditions. Physicians also prescribe it for cognitive complaints in older patients, although the evidence base for that use is thinner. Outside Russia and a few neighboring states, the substance is not an approved medicine and is sold instead as a research chemical.
Published research on this peptide originates mainly from Russian laboratories, and the wider international literature is comparatively thin. Studies have used rodent models of stroke, hypoxia, and memory tasks, with a smaller number of human trials reported. Reported outcomes include changes in attention and memory measures, along with effects on neurotrophic factor expression in some experiments. Small sample sizes, inconsistent dosing protocols, and limited independent replication are widely noted limitations, so the strength of the clinical evidence remains an open question.
Semax is a synthetic heptapeptide whose sequence is Met-Glu-His-Phe-Pro-Gly-Pro. The first four residues correspond to the ACTH(4-10) fragment, while the terminal Pro-Gly-Pro extension was added to improve metabolic stability. Its molecular formula is C37H51N9O10S and its monoisotopic mass is approximately 813.9 Da. The compound is classified as a peptide research chemical and as a registered pharmaceutical product in Russia, but it does not hold marketing approval in the European Union or the United States. Naming conventions vary across supplier catalogs.
Shriram Gadhve of All India Vegetable Growers Association (AIVGA) claims his organisation supports retail reform. He claimed that currently, it is the middlemen commission agents who benefit at the cost of farmers. He urged that the retail reform must focus on rural areas and that farmers receive benefits. Gadhve claimed, "A better cold storage would help since this could help prevent the existing loss of 34% of fruits and vegetables due to inefficient systems in place." AIVGA operates in nine states including Maharashtra, Andhra Pradesh, West Bengal, Bihar, Chhattisgarh, Punjab and Haryana with 2,200 farmer outfits as its members. Bharat Krishak Samaj, a farmer association with more than 75,000 members says it supports retail reform. Ajay Vir Jakhar, the chairman of Bharat Krishak Samaj, claimed a monopoly exists between the private guilds of middlemen, commission agents at the sabzi mandis (India's wholesale markets for vegetables and farm produce) and the small shopkeepers in the unorganised retail market. Given the perishable nature of food like fruit and vegetables, without the option of safe and reliable cold storage, the farmer is compelled to sell his crop at whatever price he can get. He cannot wait for a better price and is thus exploited by the current monopoly of middlemen. Jakhar asked that the government make it mandatory for organised retailers to buy 75% of their produce directly from farmers, bypassing the middlemen monopoly and India's sabzi mandi auction system. Consortium of Indian Farmers Associations (CIFA) announced its support for retail reform.
Border tensions continued into the early 2000s, although the two countries cooperated in other areas. The PUP won a landslide victory in the 1998 national elections, and PUP leader Said Musa was sworn in as prime minister. In the 2003 elections the PUP maintained its majority, and Musa continued as prime minister. He pledged to improve conditions in the underdeveloped and largely inaccessible southern part of Belize. In 2005, Belize was the site of unrest caused by discontent with the PUP government, including tax increases in the national budget. On 8 February 2008, Dean Barrow was sworn in as prime minister after his UDP won a landslide victory in general elections. Barrow and the UDP were re-elected in 2012 with a considerably smaller majority. Barrow led the UDP to a third consecutive general election victory in November 2015, increasing the party's number of seats from 17 to 19. He said the election would be his last as party leader and preparations are under way for the party to elect his successor. On 11 November 2020, the People's United Party (PUP), led by Johnny Briceño, defeated the United Democratic Party (UDP) for the first time since 2003, having won 26 seats out of 31 to form the new government of Belize. Briceño took office as prime minister on 12 November. In 2023, Belize became the second Central American country to be awarded certification for the elimination of malaria by the WHO.
== Main constituents == Sandalwood oil contains more than 90% sesquiterpenic alcohols of which 50–60% is the tricyclic α-santalol. β-Santalol comprises 20–25%. The composition of the oil will depend on the species, region grown, age of tree, and possibly the season of harvest and details of the extraction process used. Current International Organization for Standardization (ISO) standards for S. album oil are 41–55% α-santalol and 16–24% β–santalol (ISO 3518: 2002E).
B vitamins are a class of water-soluble vitamins that play important roles in cell metabolism and synthesis of red blood cells. They are a chemically diverse class of compounds. Dietary supplements containing all eight are referred to as a vitamin B complex. Individual B vitamins are referred to by B-number or by chemical name, such as B1 for thiamine, B2 for riboflavin, and B3 for niacin, while some are more commonly recognized by name than by number, such as pantothenic acid (B5), biotin (B7), and folate (B9). B vitamins are present in protein-rich foods, such as fish, poultry, meat, dairy products, and eggs; they are also found in leafy green vegetables, beans, and peas. Fortified foods, such as breakfast cereals, baked products, and infant formulas, may contain B vitamins. Each B vitamin is either a cofactor (generally a coenzyme) for key metabolic processes or is a precursor needed to make one.
Sources: en.wikipedia.org
The term nanoporous materials contain subsets of microporous and mesoporous materials. Microporous materials are porous materials with a mean pore size smaller than 2 nm, while mesoporous materials are those with pores sizes in the region 2–50 nm. Microporous materials exhibit pore sizes with comparable length-scale to small molecules. For this reason such materials may serve valuable applications including separation membranes. Mesoporous materials are interesting towards applications that require high specific surface areas, while enabling penetration for molecules that may be too large to enter the pores of a microporous material. In some sources, nanoporous materials and nanofoam are sometimes considered nanostructures but not nanomaterials because only the voids and not the materials themselves are nanoscale. Although the ISO definition only considers round nano-objects to be nanoparticles, other sources use the term nanoparticle for all shapes.
== Past events == In the 19th and early 20th centuries asbestos was used in many products and in building construction and was not considered a threat to human health or the environment. Deaths and lung problems caused by asbestos were first documented in the early 20th century. The first regulations of the asbestos industry were published in the UK in the 1930s. Regulation of asbestos in the US did not occur until the 1980s. In the 1970s there was a serious issue with the water treatment infrastructure of some US states, notably in Southern California with water sourced from the Sacramento–San Joaquin River Delta. Water was being disinfected for domestic use through chlorine treatment, which was effective for killing microbial contaminants and bacteria, but in some cases, it reacted with runoff chemicals and organic matter to form trihalomethanes (THMs). Research done in the subsequent years began to suggest the carcinogenic and harmful nature of this category of compounds. EPA issued its first standard for THMs, applicable to public water systems, in 1979, and more stringent standards in 1998 and 2006. Rapid industry changes also make the treatment and regulation of CEC particularly challenging. For instance, the replacing substance (GenX), for the recently regulated perfluorooctanoic acid (PFOA), a PFAS, had a more detrimental environmental impact, resulting in the subsequently banning of GenX as well. Hence, there is a pressing need for the treatment and management of CEC to keep up with global trends.
In terms of reaction mechanism, SeO2 and the allylic substrate react via pericyclic process beginning with an ene reaction that activates the C−H bond. The second step is a [2,3] sigmatropic reaction. Oxidations involving selenium dioxide are often carried out with catalytic amounts of the selenium compound and in presence of a sacrificial catalyst or co-oxidant such as hydrogen peroxide. SeO2-based oxidations sometimes afford carbonyl compounds such as ketones, β-Pinene and cyclohexanone oxidation to 1,2-cyclohexanedione. Oxidation of ketones having α-methylene groups affords diketones. This type of oxidation with selenium oxide is called Riley oxidation. Aza analogues attach an amide, rather than alcohol, at the corresponding position (Ts=Tosyl):
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
kinase Any of a class of enzymes which catalyze the transfer of phosphate groups from high-energy, phosphate-donating molecules such as ATP to one or more specific substrates, a process known as phosphorylation. The opposite process, known as dephosphorylation, is catalyzed by phosphatase enzymes.
Sources: en.wikipedia.org
DNA exists in many possible conformations that include A-DNA, B-DNA, and Z-DNA forms, although only B-DNA and Z-DNA have been directly observed in functional organisms. The conformation that DNA adopts depends on the hydration level, DNA sequence, the amount and direction of supercoiling, chemical modifications of the bases, the type and concentration of metal ions, and the presence of polyamines in solution. The first published reports of A-DNA X-ray diffraction patterns—and also B-DNA—used analyses based on Patterson functions that provided only a limited amount of structural information for oriented fibers of DNA. An alternative analysis was proposed by Wilkins et al. in 1953 for the in vivo B-DNA X-ray diffraction-scattering patterns of highly hydrated DNA fibers in terms of squares of Bessel functions. In the same journal, James Watson and Francis Crick presented their molecular modeling analysis of the DNA X-ray diffraction patterns to suggest that the structure was a double helix. Although the B-DNA form is most common under the conditions found in cells, it is not a well-defined conformation but a family of related DNA conformations that occur at the high hydration levels present in cells. Their corresponding X-ray diffraction and scattering patterns are characteristic of molecular paracrystals with a significant degree of disorder. Compared to B-DNA, the A-DNA form is a wider right-handed spiral, with a shallow, wide minor groove and a narrower, deeper major groove.
In 1973, he initiated a "Popular Revolution" with the formation of Basic People's Congresses, presented as a system of direct democracy, but retained personal control over major decisions. He outlined his Third International Theory that year in The Green Book. In 1977, Gaddafi transformed Libya into a new socialist state called a Jamahiriya ("state of the masses"). He officially adopted a symbolic role in governance but remained head of both the military and the Revolutionary Committees responsible for policing and suppressing dissent. During the 1970s and 1980s, Libya's unsuccessful border conflicts with Egypt and Chad, support for foreign militants and alleged responsibility for bombings of Pan Am Flight 103 and UTA Flight 772 left it increasingly isolated on the world stage. A particularly hostile relationship developed with Israel, the United States and the United Kingdom, resulting in the 1986 U.S. bombing of Libya and United Nations–imposed economic sanctions. From 1999, Gaddafi shunned pan-Arabism, and encouraged pan-Africanism and rapprochement with Western nations; he was Chairperson of the African Union from 2009 to 2010. Amid the 2011 Arab Spring, protests against widespread corruption and unemployment broke out in eastern Libya. The situation descended into civil war, in which NATO intervened militarily on the side of the anti-Gaddafist National Transitional Council (NTC). Gaddafi's government was overthrown; he retreated to Sirte only to be captured, tortured and killed by NTC militants.
== Science and technology == Process capability index (Cpk), a measure of process capability CPK coloring, a way to color atoms when visualizing molecular models Creatine phosphokinase, an enzyme found in humans, or alternatively a blood test for it
Though phallotoxins are highly toxic to liver cells, they have since been found to add little to the death cap's toxicity, as they are not absorbed through the gut. Furthermore, phalloidin is also found in the edible (and sought-after) blusher (A. rubescens). Another group of minor active peptides are the virotoxins, which consist of six similar monocyclic heptapeptides. Like the phallotoxins, they do not induce any acute toxicity after ingestion in humans. The genome of the death cap has been sequenced.
Half-Life 2 was followed by the free extra level Lost Coast (2005) and the episodic sequels Episode One (2006) and Episode Two (2007). In 2020, after canceling Episode Three and several further Half-Life projects, Valve released a prequel, Half-Life: Alyx.
Sources: en.wikipedia.org
It is a synthetic seven-amino-acid peptide built from the ACTH(4-7) sequence plus a Pro-Gly-Pro tail. It belongs to the family of short ACTH fragments studied for nervous-system effects. Its backbone contains only standard amino acids.
It contains the 4-7 fragment of adrenocorticotropic hormone extended at the C terminus. That truncation removes the region associated with steroidogenic activity. The design intent was to keep neurotrophic properties while avoiding full hormonal effects.
No natural source of the intact heptapeptide is known. It is produced by solid-phase peptide synthesis. Some related ACTH fragments arise as hormone processing products, but the Pro-Gly-Pro extension is a designed addition rather than a natural sequence.
The sequence is Met-Glu-His-Phe-Pro-Gly-Pro, a seven-residue peptide. The first four residues correspond to the ACTH(4-10) fragment, and Pro-Gly-Pro is added at the C-terminus. N-acetylated versions also appear in the literature and differ in mass.