The short version of Moisture content fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-09-18 and is reviewed periodically as new material appears.
In chemical terms, creatine monohydrate is often described as N-(aminoiminomethyl)-N-methylglycine monohydrate, though nomenclature varies. Its solid state consists of zwitterionic creatine molecules linked with water through hydrogen bonding. The compound dissolves in water, but dissolution rate depends on particle size, temperature, and agitation. Once dissolved, the hydrate water becomes part of the solvent, leaving free creatine in solution. The monohydrate is not the same as creatine anhydrous, which lacks the water of crystallization and has a higher creatine fraction by mass.
Commercial creatine monohydrate is typically a white to off-white powder with low odor. It is commonly sold as a fine powder, micronized powder, or larger crystals, but these are physical forms of the same chemical. Purity grades vary, and products may contain small amounts of related substances such as creatinine, dicyandiamide, or moisture. The monohydrate is often selected for supplements and research because its production is well established and its behavior in water is predictable. Analytical certificates usually report assay, loss on drying, and heavy metals.
Commercial creatine monohydrate is produced mainly by chemical synthesis rather than extraction from animal tissue. Suppliers provide a certificate of analysis listing assay, water content, and impurity limits, and some products undergo third-party testing. Verification of identity can use infrared or Raman spectroscopy alongside chromatographic methods. Storage recommendations generally call for a cool, dry place and a tightly closed container to limit moisture uptake. Open questions include how packaging, flavoring agents, and long-term storage affect the stability of finished products.
Dry creatine monohydrate is generally stable when kept sealed and protected from heat and moisture. In solution, however, creatine undergoes a slow cyclization to creatinine, a related compound with no role in phosphocreatine storage. The rate of this conversion increases with temperature and is influenced by pH. Because creatinine is a common impurity in liquid or poorly stored products, analytical testing often measures both compounds. The crystalline monohydrate is less prone to degradation than aqueous preparations, though caking can occur if moisture enters the container.
| Property | Value | Notes |
|---|---|---|
| Chemical name | N-(aminoiminomethyl)-N-methylglycine monohydrate | Nomenclature varies across sources. |
| Common synonyms | Creatine hydrate; creatine monohydrate | “Monohydrate” specifies one water per creatine. |
| Appearance | White to off-white crystalline powder | Particle size and flowability vary by grade. |
| Solubility class | Soluble in water; slightly soluble in ethanol | Dissolution increases with temperature and stirring. |
| Typical storage | Tightly closed container at 15–25 °C | Protect from moisture and excessive heat. |
In the body, creatine is obtained from dietary meat and fish and is also synthesized from arginine, glycine, and methionine. Muscle stores creatine and phosphocreatine, which participate in the rapid regeneration of adenosine triphosphate during short, intense activity. The monohydrate form is used in research because it is chemically defined, stable as a dry solid, and relatively inexpensive to produce. Questions remain about whether other creatine forms offer meaningful advantages in absorption or tissue retention, and findings vary across studies and populations.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Creatine itself is a nitrogen-containing organic acid that occurs in vertebrate muscle and other tissues. The monohydrate designation refers to the water included in the crystal lattice, not to water added during manufacturing. Its chemical formula is commonly written as C4H9N3O2·H2O. The solid is typically a white, odorless powder with low solubility in water at room temperature. It is one of several creatine forms described in scientific and commercial literature.
Regulatory status varies by country. In the United States, creatine monohydrate is sold as a dietary supplement ingredient, while in the European Union it is placed on the market as a food supplement component. Some jurisdictions have established purity monographs or permitted health claims, while others treat it as a novel food or require notification. Product labels may state the amount of creatine monohydrate or the equivalent creatine content, and the two figures can differ. Independent testing programs sometimes check identity, potency, and contaminant limits.
Creatine monohydrate is stable under dry, cool conditions but can degrade when exposed to moisture and heat. In solution, it undergoes hydrolysis to creatinine, a cyclic derivative with little role in phosphagen energy transfer. The rate of conversion increases with temperature, storage time, and acidic or alkaline pH. Solid material kept in a sealed container at room temperature generally retains its composition for extended periods. Moisture uptake is a primary concern because it can accelerate breakdown and caking.
Analytical laboratories commonly use high-performance liquid chromatography to separate creatine from creatinine and related impurities. Ion chromatography, nuclear magnetic resonance, and titration assays can also quantify the compound. Water content is measured by Karl Fischer titration or loss on drying, because the monohydrate has a defined theoretical water fraction. Particle size, bulk density, and flowability are physical properties that affect blending and capsule filling. These measurements support quality control and help verify that a lot matches its specification.
Analytical laboratories commonly identify creatine monohydrate by high-performance liquid chromatography with ultraviolet detection, often after dissolving the sample in water or dilute acid. Ion-exchange or reversed-phase columns separate creatine from creatinine and related guanidino compounds. Nitrogen content can be checked by Kjeldahl or combustion methods, while moisture is measured by Karl Fischer titration or loss on drying. These techniques give complementary views: chromatographic purity addresses related substances, whereas moisture and elemental data confirm hydrate stoichiometry. No single test defines quality by itself; a combination is used in specifications.
Storage recommendations generally emphasize a cool, dry place away from direct sunlight and strong oxidizers. Sealed containers limit humidity exchange, which helps prevent clumping and gradual conversion to creatinine. Long-term stability studies usually monitor appearance, moisture, and purity at intervals under defined temperature and humidity conditions. Accelerated tests at elevated temperature can reveal degradation pathways, but they do not perfectly predict room-temperature shelf life. Questions remain about how much creatinine formation is acceptable in different product categories and how packaging choices affect that rate over time.
Commercial creatine monohydrate is typically manufactured through chemical synthesis, often starting from sarcosine and cyanamide. The resulting material is crystallized, washed, and dried to a specified hydrate content. Finished lots are tested for identity, purity, moisture, and heavy metals before release. Because the compound can cyclize to creatinine under heat or prolonged storage in solution, manufacturers control temperature and humidity during processing. The solid itself is relatively stable when kept dry and sealed, but moisture uptake can cause caking and complicate accurate assay.
Apamin is an 18 amino acid globular peptide neurotoxin found in apitoxin (bee venom). Dry bee venom consists of 2–3% of apamin. Apamin selectively blocks SK channels, a type of Ca2+-activated K+ channel expressed in the central nervous system. Toxicity is caused by only a few amino acids, in particular cysteine1, lysine4, arginine13, arginine14 and histidine18. These amino acids are involved in the binding of apamin to the Ca2+-activated K+ channel. Due to its specificity for SK channels, apamin is used as a drug in biomedical research to study the electrical properties of SK channels and their role in the afterhyperpolarizations occurring immediately following an action potential.
Nanoghosts are nanosized vesicles containing a chosen drug delivery payload manufactured from extracted leukocyte membranes with the cell cytoplasm content removed. The use of biological membranes serves to mask the particles from the immune system to reduce the likelihood of an immunogenic response, as well as to extend circulation of the particles in the blood. They are produced by homogenizing the cells to remove the cytosol, and then sonicating the empty cell membranes to create nanoghosts between 100 and 200 nm in diameter. Membranes used to make nanoghosts harvested form red blood cells have been shown to circulate for about 120 days and avoid phagocytotic cells. Neutrophil based nanoghosts retain the chemotaxis capacity of neutrophils to sites of inflammation, which encourages tumor targeting. NK based nanoghosts exhibit metastatic cancer targeting behavior. Monocyte based nanoghosts are effective at infiltrating the tumor microenvironment. Mesenchymal stem cell derived nanoghosts exhibit cancer targeting properties.
Biochemistry is the study of chemical processes within and relating to living organisms. Molecular biology is the branch of biology that seeks to understand the molecular basis of biological activity in and between cells. It is centered largely on the study of nucleic acids (such as DNA and RNA) and proteins. It examines the structure, function, and interactions of these macromolecules as they orchestrate processes such as replication, transcription, translation, protein synthesis, and complex biomolecular interactions. In 1953, the Miller–Urey experiment showed that organic compounds could be synthesized abiotically within a closed system mimicking the conditions of early Earth, thus suggesting that complex organic molecules could have arisen spontaneously in early Earth in the process of abiogenesis.
Initial letters are used where there is no ambiguity: C cysteine, H histidine, I isoleucine, M methionine, S serine, V valine. No other amino acids in this set begin with each of those letters. Where arbitrary assignment is needed, the structurally simpler amino acids are given precedence: A alanine, G glycine, L leucine, P proline, T threonine. For example, alanine is simpler than arginine or asparagine, the other amino acids starting with "a". F PHenylalanine and R aRginine are assigned by being phonetically suggestive, W tryptophan is assigned based on the double ring being visually suggestive to the bulky letter W, K lysine and Y tyrosine are assigned as alphabetically nearest to their initials L and T (note that U was avoided for its similarity with V, while X was reserved for undetermined or atypical amino acids); for tyrosine the mnemonic tYrosine was also proposed, D aspartate was assigned arbitrarily, with the proposed mnemonic asparDic acid; E glutamate was assigned in alphabetical sequence being larger by merely one methylene –CH2– group, N asparagine was assigned arbitrarily, with the proposed mnemonic asparagiNe; Q glutamine was assigned in alphabetical sequence of those still available (note again that O was avoided due to similarity with D), with the proposed mnemonic Qlutamine.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Degradation of an amino acid often begins with transamination, in which its amino group is transferred to α-ketoglutarate, forming glutamate. This process involves transaminases, often the same enzymes used in amino acid synthesis. In many vertebrates, the amino group is subsequently released as ammonia and converted to urea via the urea cycle for excretion. However, amino acid degradation can result in uric acid or ammonia instead, depending on the organism. For example, serine dehydratase converts serine directly to pyruvate and ammonia. After removal of one or more amino groups, the remaining carbon skeleton of an amino acid can serve as a precursor for synthesizing other amino acids, be further metabolized for energy after conversion into intermediates of glycolysis (typically via gluconeogenesis) or of the citric acid cycle, or be used for fatty acid synthesis and storage as triacylglycerol. Amino acids are bidentate ligands, forming transition metal amino acid complexes.
While juxtaposed against free-radical polymerization, the application of automated synthesis can be utilized for controlled radical polymerization too. These methods have been used within reversible addition-fragmentation transfer (RAFT), atom-transfer radical (ATRP), and nitroxide-mediated polymerizations, demonstrating the ability of robots to improve efficiency and reduce the hardship of performing reactions. For example, with the automatic dispensation of reagents, Symyx Technologies Inc. was able to polymerize styrene and butyl acrylate through ATRP. In addition, this functionality was supported by Zhang et al. within their research, finding that reproducibility and comparability were equivalent to classical ATRP.
In both pharmacology and nutrition sciences, bioavailability is measured by calculating the area under curve (AUC) of the drug concentration time profile. Bioavailability is a term used to describe the percentage of an administered dose of a xenobiotic that reaches the systemic circulation unchanged. It is denoted by the letter f (or, if expressed in percent, by F). In nutritional science, which covers the intake of nutrients and non-drug dietary ingredients, the concept of bioavailability lacks the well-defined standards associated with the pharmaceutical industry. The pharmacological definition cannot apply to these substances because utilization and absorption is a function of the nutritional status and physiological state of the subject, resulting in even greater differences from individual to individual (inter-individual variation). Therefore, bioavailability for dietary supplements can be defined as the proportion of the administered substance capable of being absorbed and available for use or storage.
Amyloid beta (Aβ, Abeta or beta-amyloid) denotes peptides of 36–43 amino acids that are the main component of the amyloid plaques found in the brains of people with Alzheimer's disease. The peptides derive from the amyloid-beta precursor protein (APP), which is cleaved by beta secretase and gamma secretase to yield Aβ in a cholesterol-dependent process and substrate presentation. Both neurons and oligodendrocytes produce and release Aβ in the brain, contributing to formation of amyloid plaques. Aβ molecules can aggregate to form flexible soluble oligomers which may exist in several forms. It is now believed that certain misfolded oligomers (known as "seeds") can induce other Aβ molecules to also take the misfolded oligomeric form, leading to a chain reaction akin to a prion infection. The oligomers are toxic to nerve cells. The other protein implicated in Alzheimer's disease, tau protein, also forms such prion-like misfolded oligomers, and there is some evidence that misfolded Aβ can induce tau to misfold. A study has suggested that APP and its amyloid potential is of ancient origins, dating as far back as early deuterostomes.
Camurus AB (publ) is a Swedish research-based pharmaceutical and biotechnology company specialising in the commercialization of medicines for treating serious and chronic diseases. Established in 1991 and based in the southern university city of Lund, in the Medicon Valley region, the company is listed on Nasdaq Stockholm, Mid Cap. Camurus was founded by scientists in biophysical, food, and pharmaceutical chemistry with expertise in lipid phase structures. The company provides nanoscale drug-delivery systems for development of high-value therapeutics.
Sources: en.wikipedia.org
It is a solid form of creatine that contains one water molecule per creatine molecule in the crystal lattice. The hydrate water is part of the crystal structure rather than loose moisture. The term is often used for the common crystalline powder grade.
Creatine anhydrous lacks the water of crystallization and therefore contains a higher creatine fraction by mass. The monohydrate is more common in commerce and research because it is stable and easy to handle. The two forms are not identical in solid state, though both yield creatine when dissolved.
Creatine is the base molecule, while creatine monohydrate is a hydrate of that molecule. Once dissolved, the hydrate water becomes part of the solvent and free creatine is present. In casual usage the names are often shortened to creatine, but the solid forms differ.
Purity testing often uses high-performance liquid chromatography to measure creatine and creatinine. Water content can be checked by Karl Fischer titration. Additional tests may cover heavy metals, residual solvents, and microbial contamination.